PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00026879-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 233aa    MW: 26146.5 Da    PI: 6.5816
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00026879-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1733.3e-5466160195
                  NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                            vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+tsea+d+cqre+rkti+++d+lwa+++lGf+dy+epl+vyl+
  SMil_00026879-RA_Salv  66 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLH 153
                            69************************************************************************************** PP

                  NF-YB  89 kyreleg 95 
                            +yre++g
  SMil_00026879-RA_Salv 154 RYREFDG 160
                            ****987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-5061164IPR009072Histone-fold
SuperFamilySSF471138.69E-3969168IPR009072Histone-fold
PfamPF008086.0E-2672136IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.4E-17100118No hitNo description
PROSITE patternPS006850103119IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.4E-17119137No hitNo description
PRINTSPR006152.4E-17138156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MELGGNNGGF HGYRRLTTTN SGEFPCSSSS SSLIGIMYEL IKKKNDVGGG KADMNQHGGE  60
ESECIVREQD RFMPIANVIR IMRKILPPHA KISDDAKETI QECVSEYISF ITSEANDRCQ  120
REQRKTITAE DVLWAMSKLG FDDYIEPLTV YLHRYREFDG GERGSLRGEP LVKRMVDHAS  180
MGFHAFPPPA FHHIPHQHGF FGAAPMNFFK DSPNAGPSTV ACIEPFPQHK DQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A8e-3967157393NF-YB
4awl_B7e-3967157494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A7e-3967157494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095910.11e-111PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W664e-71NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLD7SZ492e-89D7SZ49_VITVI; Putative uncharacterized protein
STRINGVIT_00s0956g00020.t015e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.11e-69nuclear factor Y, subunit B6